Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (11 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [255363] (1 PDB entry) |
Domain d2knba_: 2knb A: [242578] Other proteins in same PDB: d2knbb_ automated match to d3dbhi_ |
PDB Entry: 2knb (more details)
SCOPe Domain Sequences for d2knba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2knba_ d.15.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mivfvrfnssygfpvevdsdtsifqlkevvakrqgvpadqlrvifagkelqnhltvqncd leqqsivhivqrpqrk
Timeline for d2knba_: