Lineage for d2kn7d_ (2kn7 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715662Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2715718Family a.60.2.5: Hef domain-like [140629] (4 proteins)
    helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)
  6. 2715742Protein automated matches [254584] (1 species)
    not a true protein
  7. 2715743Species Human (Homo sapiens) [TaxId:9606] [255362] (1 PDB entry)
  8. 2715745Domain d2kn7d_: 2kn7 D: [242577]
    automated match to d1z00b1
    protein/DNA complex

Details for d2kn7d_

PDB Entry: 2kn7 (more details)

PDB Description: Structure of the XPF-single strand DNA complex
PDB Compounds: (D:) DNA repair endonuclease XPF

SCOPe Domain Sequences for d2kn7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kn7d_ a.60.2.5 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekynpgpqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaanakqlydfi
htsfaev

SCOPe Domain Coordinates for d2kn7d_:

Click to download the PDB-style file with coordinates for d2kn7d_.
(The format of our PDB-style files is described here.)

Timeline for d2kn7d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2kn7a_