| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
| Family a.60.2.5: Hef domain-like [140629] (4 proteins) helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft) |
| Protein automated matches [254584] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255362] (1 PDB entry) |
| Domain d2kn7a_: 2kn7 A: [242576] automated match to d1z00b1 protein/DNA complex |
PDB Entry: 2kn7 (more details)
SCOPe Domain Sequences for d2kn7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kn7a_ a.60.2.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekynpgpqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaanakqlydfi
htsfaev
Timeline for d2kn7a_: