SCOPe 2.08: Domain d2kn7a_: 2kn7 A:

Lineage for d2kn7a_ (2kn7 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.5: Hef domain-like [140629] (4 proteins)
   helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)

6. Protein automated matches [254584] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255362] (1 PDB entry)

8. Domain d2kn7a_: 2kn7 A: [242576]
   automated match to d1z00b1
   protein/DNA complex

Details for d2kn7a_

PDB Entry: 2kn7

PDB Description: Structure of the XPF-single strand DNA complex

PDB Compounds: (A:) DNA repair endonuclease XPF

SCOPe Domain Sequences for d2kn7a_:

Sequence; same for both SEQRES and ATOM records:

>d2kn7a_ a.60.2.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekynpgpqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaanakqlydfi
htsfaev

Timeline for d2kn7a_:

• d2kn7a_ first appeared in SCOPe 2.04
  
• d2kn7a_ appears in SCOPe 2.07