Lineage for d2kmya_ (2kmy A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734167Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2734176Protein Cytochrome c3 [48697] (7 species)
    contains four heme groups
  7. 2734184Species Desulfovibrio desulfuricans, different strains [TaxId:876] [48698] (10 PDB entries)
    Uniprot Q9L915
  8. 2734193Domain d2kmya_: 2kmy A: [242574]
    automated match to d1up9a_
    complexed with hec

Details for d2kmya_

PDB Entry: 2kmy (more details)

PDB Description: nmr solution structures of fully oxidised cytochrome c3 from desulfovibrio desulfuricans atcc 27774
PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d2kmya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kmya_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]}
apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp

SCOPe Domain Coordinates for d2kmya_:

Click to download the PDB-style file with coordinates for d2kmya_.
(The format of our PDB-style files is described here.)

Timeline for d2kmya_: