![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
![]() | Protein Cytochrome c3 [48697] (7 species) contains four heme groups |
![]() | Species Desulfovibrio desulfuricans, different strains [TaxId:876] [48698] (10 PDB entries) Uniprot Q9L915 |
![]() | Domain d2kmya_: 2kmy A: [242574] automated match to d1up9a_ complexed with hec |
PDB Entry: 2kmy (more details)
SCOPe Domain Sequences for d2kmya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kmya_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]} apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp
Timeline for d2kmya_: