Lineage for d2kmta_ (2kmt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784275Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2784276Family b.34.6.1: CcdB [50119] (1 protein)
    automatically mapped to Pfam PF01845
  6. 2784277Protein CcdB [50120] (2 species)
    topoisomerase poison
  7. 2784299Species Vibrio fischeri [TaxId:668] [189154] (7 PDB entries)
  8. 2784310Domain d2kmta_: 2kmt A: [242572]
    automated match to d3jsca_

Details for d2kmta_

PDB Entry: 2kmt (more details)

PDB Description: nmr solution structure of vibrio fischeri ccdb
PDB Compounds: (A:) ccdb

SCOPe Domain Sequences for d2kmta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kmta_ b.34.6.1 (A:) CcdB {Vibrio fischeri [TaxId: 668]}
msqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpielldkkapshlcptihi
degdfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi

SCOPe Domain Coordinates for d2kmta_:

Click to download the PDB-style file with coordinates for d2kmta_.
(The format of our PDB-style files is described here.)

Timeline for d2kmta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2kmtb_