Lineage for d1gnhf_ (1gnh F:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556441Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 556442Protein C-reactive protein (CRP) [49954] (1 species)
  7. 556443Species Human (Homo sapiens) [TaxId:9606] [49955] (3 PDB entries)
  8. 556464Domain d1gnhf_: 1gnh F: [24257]

Details for d1gnhf_

PDB Entry: 1gnh (more details), 3 Å

PDB Description: human c-reactive protein

SCOP Domain Sequences for d1gnhf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnhf_ b.29.1.5 (F:) C-reactive protein (CRP) {Human (Homo sapiens)}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOP Domain Coordinates for d1gnhf_:

Click to download the PDB-style file with coordinates for d1gnhf_.
(The format of our PDB-style files is described here.)

Timeline for d1gnhf_: