SCOPe 2.05: Domain d2kmka_: 2kmk A:

Lineage for d2kmka_ (2kmk A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.0: automated matches [196454] (1 protein)
   not a true family

6. Protein automated matches [196455] (4 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255360] (1 PDB entry)

8. Domain d2kmka_: 2kmk A: [242565]
   automated match to d2wbsa_
   protein/DNA complex; complexed with zn

Details for d2kmka_

PDB Entry: 2kmk

PDB Description: gfi-1 zinc fingers 3-5 complexed with dna

PDB Compounds: (A:) Zinc finger protein Gfi-1

SCOPe Domain Sequences for d2kmka_:

Sequence; same for both SEQRES and ATOM records:

>d2kmka_ g.37.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sfdckicgksfkrsstlsthllihsdtrpypcqycgkrfhqksdmkkhtfihtgekphkc
qvcgkafsqssnlithsrkhtg

Timeline for d2kmka_:

• d2kmka_ first appeared in SCOPe 2.04
  
• d2kmka_ appears in SCOPe 2.06
  
• d2kmka_ appears in the current release, SCOPe 2.08