SCOPe 2.07: Domain d2kmda1: 2kmd A:29-138

Lineage for d2kmda1 (2kmd A:29-138)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (7 proteins)

6. Protein automated matches [254583] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255359] (1 PDB entry)

8. Domain d2kmda1: 2kmd A:29-138 [242564]
   Other proteins in same PDB: d2kmda2
   automated match to d2jv3a_

Details for d2kmda1

PDB Entry: 2kmd

PDB Description: Ras signaling requires dynamic properties of Ets1 for phosphorylation-enhanced binding to co-activator CBP

PDB Compounds: (A:) Protein C-ets-1

SCOPe Domain Sequences for d2kmda1:

Sequence; same for both SEQRES and ATOM records:

>d2kmda1 a.60.1.1 (A:29-138) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mecadvplltpsskemmsqalkatfsgftkeqqrlgipkdprqwtethvrdwvmwavnef
slkgvdfqkfcmsgaalcalgkecflelapdfvgdilwehleilqkedvk

Timeline for d2kmda1:

• d2kmda1 first appeared in SCOPe 2.04, called d2kmda_
  
• d2kmda1 appears in SCOPe 2.06