![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.1: Pointed domain [47770] (7 proteins) |
![]() | Protein automated matches [254583] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255359] (1 PDB entry) |
![]() | Domain d2kmda1: 2kmd A:29-138 [242564] Other proteins in same PDB: d2kmda2 automated match to d2jv3a_ |
PDB Entry: 2kmd (more details)
SCOPe Domain Sequences for d2kmda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kmda1 a.60.1.1 (A:29-138) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mecadvplltpsskemmsqalkatfsgftkeqqrlgipkdprqwtethvrdwvmwavnef slkgvdfqkfcmsgaalcalgkecflelapdfvgdilwehleilqkedvk
Timeline for d2kmda1: