Lineage for d2kmda1 (2kmd A:29-138)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715429Family a.60.1.1: Pointed domain [47770] (7 proteins)
  6. 2715470Protein automated matches [254583] (2 species)
    not a true protein
  7. 2715474Species Mouse (Mus musculus) [TaxId:10090] [255359] (1 PDB entry)
  8. 2715475Domain d2kmda1: 2kmd A:29-138 [242564]
    Other proteins in same PDB: d2kmda2
    automated match to d2jv3a_

Details for d2kmda1

PDB Entry: 2kmd (more details)

PDB Description: Ras signaling requires dynamic properties of Ets1 for phosphorylation-enhanced binding to co-activator CBP
PDB Compounds: (A:) Protein C-ets-1

SCOPe Domain Sequences for d2kmda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kmda1 a.60.1.1 (A:29-138) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mecadvplltpsskemmsqalkatfsgftkeqqrlgipkdprqwtethvrdwvmwavnef
slkgvdfqkfcmsgaalcalgkecflelapdfvgdilwehleilqkedvk

SCOPe Domain Coordinates for d2kmda1:

Click to download the PDB-style file with coordinates for d2kmda1.
(The format of our PDB-style files is described here.)

Timeline for d2kmda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kmda2