SCOPe 2.06: Domain d2km8c2: 2km8 C:242-322

Lineage for d2km8c2 (2km8 C:242-322)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (9 PDB entries)

8. Domain d2km8c2: 2km8 C:242-322 [242563]
   automated match to d1u1qa2
   protein/RNA complex

Details for d2km8c2

PDB Entry: 2km8

PDB Description: interdomain rrm packing contributes to rna recognition in the rna15, hrp1, anchor rna 3' processing ternary complex

PDB Compounds: (C:) nuclear polyadenylated RNA-binding protein 4

SCOPe Domain Sequences for d2km8c2:

Sequence; same for both SEQRES and ATOM records:

>d2km8c2 d.58.7.0 (C:242-322) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tgkifvggigpdvrpkefeeffsqwgtiidaqlmldkdtgqsrgfgfvtydsadavdrvc
qnkfidfkdrkieikraeprh

Timeline for d2km8c2:

• d2km8c2 first appeared in SCOPe 2.04
  
• d2km8c2 appears in SCOPe 2.05
  
• d2km8c2 appears in SCOPe 2.07
  
• d2km8c2 appears in the current release, SCOPe 2.08