Lineage for d2km8c1 (2km8 C:156-241)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195631Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2195632Protein automated matches [190896] (11 species)
    not a true protein
  7. 2195633Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (9 PDB entries)
  8. 2195648Domain d2km8c1: 2km8 C:156-241 [242562]
    automated match to d1u1qa1
    protein/RNA complex

Details for d2km8c1

PDB Entry: 2km8 (more details)

PDB Description: interdomain rrm packing contributes to rna recognition in the rna15, hrp1, anchor rna 3' processing ternary complex
PDB Compounds: (C:) nuclear polyadenylated RNA-binding protein 4

SCOPe Domain Sequences for d2km8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2km8c1 d.58.7.0 (C:156-241) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kesckmfigglnwdttednlreyfgkygtvtdlkimkdpatgrsrgfgflsfekpssvde
vvktqhildgkvidpkraiprdeqdk

SCOPe Domain Coordinates for d2km8c1:

Click to download the PDB-style file with coordinates for d2km8c1.
(The format of our PDB-style files is described here.)

Timeline for d2km8c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2km8c2
View in 3D
Domains from other chains:
(mouse over for more information)
d2km8b_