Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (9 PDB entries) |
Domain d2km8c1: 2km8 C:156-241 [242562] automated match to d1u1qa1 protein/RNA complex |
PDB Entry: 2km8 (more details)
SCOPe Domain Sequences for d2km8c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2km8c1 d.58.7.0 (C:156-241) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kesckmfigglnwdttednlreyfgkygtvtdlkimkdpatgrsrgfgflsfekpssvde vvktqhildgkvidpkraiprdeqdk
Timeline for d2km8c1: