Lineage for d1gnhe_ (1gnh E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12752Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 12753Protein C-reactive protein (CRP) [49954] (1 species)
  7. 12754Species Human (Homo sapiens) [TaxId:9606] [49955] (2 PDB entries)
  8. 12764Domain d1gnhe_: 1gnh E: [24256]

Details for d1gnhe_

PDB Entry: 1gnh (more details), 3 Å

PDB Description: human c-reactive protein

SCOP Domain Sequences for d1gnhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnhe_ b.29.1.5 (E:) C-reactive protein (CRP) {Human (Homo sapiens)}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOP Domain Coordinates for d1gnhe_:

Click to download the PDB-style file with coordinates for d1gnhe_.
(The format of our PDB-style files is described here.)

Timeline for d1gnhe_: