SCOPe 2.07: Domain d2klxa1: 2klx A:1-85

Lineage for d2klxa1 (2klx A:1-85)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Bartonella henselae [TaxId:283166] [255358] (1 PDB entry)

8. Domain d2klxa1: 2klx A:1-85 [242557]
   Other proteins in same PDB: d2klxa2
   automated match to d1fova_

Details for d2klxa1

PDB Entry: 2klx

PDB Description: solution structure of glutaredoxin from bartonella henselae str. houston

PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d2klxa1:

Sequence; same for both SEQRES and ATOM records:

>d2klxa1 c.47.1.0 (A:1-85) automated matches {Bartonella henselae [TaxId: 283166]}
mkeiilytrpncpyckrardlldkkgvkytdidastslrqemvqrangrntfpqifigdy
hvggcddlyalenkgkldsllqdvh

Timeline for d2klxa1:

• d2klxa1 first appeared in SCOPe 2.04, called d2klxa_
  
• d2klxa1 appears in SCOPe 2.06
  
• d2klxa1 appears in the current release, SCOPe 2.08