![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.27: CalX-like [141072] (2 families) ![]() |
![]() | Family b.1.27.1: CalX-beta domain [141073] (2 proteins) Pfam PF03160 |
![]() | Protein automated matches [227001] (3 species) not a true protein |
![]() | Species Dog (Canis familiaris) [TaxId:9615] [255357] (2 PDB entries) |
![]() | Domain d2klsa1: 2kls A:502-657 [242554] Other proteins in same PDB: d2klsa2 automated match to d2fwua1 |
PDB Entry: 2kls (more details)
SCOPe Domain Sequences for d2klsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2klsa1 b.1.27.1 (A:502-657) automated matches {Dog (Canis familiaris) [TaxId: 9615]} agiftfeepvthvsesigimevkvlrtsgargnvivpyktiegtargggedfedtcgele fqndeivktisvkviddeeyeknktffleigeprlvemsekkggftiteeyddkqpltsk eeeerriaemgrpilgehtkleviieesyefkstvd
Timeline for d2klsa1: