SCOPe 2.04: Domain d2klsa_: 2kls A:

Lineage for d2klsa_ (2kls A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.27: CalX-like [141072] (2 families)

5. Family b.1.27.1: CalX-beta domain [141073] (2 proteins)
   Pfam PF03160

6. Protein automated matches [227001] (3 species)
   not a true protein

7. Species Dog (Canis familiaris) [TaxId:9615] [255357] (2 PDB entries)

8. Domain d2klsa_: 2kls A: [242554]
   automated match to d2fwua1

Details for d2klsa_

PDB Entry: 2kls

PDB Description: apo-form of the second ca2+ binding domain of ncx1.4

PDB Compounds: (A:) Sodium/calcium exchanger 1

SCOPe Domain Sequences for d2klsa_:

Sequence; same for both SEQRES and ATOM records:

>d2klsa_ b.1.27.1 (A:) automated matches {Dog (Canis familiaris) [TaxId: 9615]}
hagiftfeepvthvsesigimevkvlrtsgargnvivpyktiegtargggedfedtcgel
efqndeivktisvkviddeeyeknktffleigeprlvemsekkggftiteeyddkqplts
keeeerriaemgrpilgehtkleviieesyefkstvd

Timeline for d2klsa_:

• d2klsa_ is new in SCOPe 2.04-stable
  
• d2klsa_ appears in SCOPe 2.05
  
• d2klsa_ appears in the current release, SCOPe 2.08, called d2klsa1