Lineage for d1gnhd_ (1gnh D:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460391Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 460392Protein C-reactive protein (CRP) [49954] (1 species)
  7. 460393Species Human (Homo sapiens) [TaxId:9606] [49955] (3 PDB entries)
  8. 460412Domain d1gnhd_: 1gnh D: [24255]

Details for d1gnhd_

PDB Entry: 1gnh (more details), 3 Å

PDB Description: human c-reactive protein

SCOP Domain Sequences for d1gnhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnhd_ b.29.1.5 (D:) C-reactive protein (CRP) {Human (Homo sapiens)}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOP Domain Coordinates for d1gnhd_:

Click to download the PDB-style file with coordinates for d1gnhd_.
(The format of our PDB-style files is described here.)

Timeline for d1gnhd_: