SCOPe 2.08: Domain d2kl4a1: 2kl4 A:4-118

Lineage for d2kl4a1 (2kl4 A:4-118)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.4: YdhG-like [159888] (1 family)
   some similarity to YjbR-like (136320)
   automatically mapped to Pfam PF08818

5. Family d.198.4.1: YdhG-like [159889] (3 proteins)
   Pfam PF08818; DUF1801

6. Protein automated matches [254582] (1 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:86665] [255354] (1 PDB entry)

8. Domain d2kl4a1: 2kl4 A:4-118 [242549]
   Other proteins in same PDB: d2kl4a2
   automated match to d2oc6a1

Details for d2kl4a1

PDB Entry: 2kl4

PDB Description: nmr structure of the protein nb7804a

PDB Compounds: (A:) BH2032 protein

SCOPe Domain Sequences for d2kl4a1:

Sequence; same for both SEQRES and ATOM records:

>d2kl4a1 d.198.4.1 (A:4-118) automated matches {Bacillus halodurans [TaxId: 86665]}
mevfaeylkgidhpdhrdrteeilswvaatfpnlepqmkwntpmfsnqgtfiigfstskh
hlsvspeeigisqfadaiaqagysatkglfripwndpvhyellkqmiefniqdke

Timeline for d2kl4a1:

• d2kl4a1 first appeared in SCOPe 2.04, called d2kl4a_
  
• d2kl4a1 appears in SCOPe 2.07