![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.7: Synuclein [118374] (1 superfamily) |
![]() | Superfamily h.7.1: Synuclein [118375] (1 family) ![]() |
![]() | Family h.7.1.1: Synuclein [118376] (2 proteins) Pfam PF01387 |
![]() | Protein automated matches [254581] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255353] (2 PDB entries) |
![]() | Domain d2kkwa_: 2kkw A: [242546] automated match to d1xq8a_ |
PDB Entry: 2kkw (more details)
SCOPe Domain Sequences for d2kkwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kkwa_ h.7.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdvfmkglskakegvvaaaektkqgvaeaagktkegvlyvgsktkegvvhgvatvaektk eqvtnvggavvtgvtavaqktvegagsiaaatgfvkkdqlgkneegapqegiledmpvdp dneayempseegyqdyepea
Timeline for d2kkwa_: