SCOPe 2.07: Domain d2kk6a1: 2kk6 A:12-116

Lineage for d2kk6a1 (2kk6 A:12-116)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries)

8. Domain d2kk6a1: 2kk6 A:12-116 [242542]
   Other proteins in same PDB: d2kk6a2
   automated match to d3uyoa_

Details for d2kk6a1

PDB Entry: 2kk6

PDB Description: solution structure of sh2 domain of proto-oncogene tyrosine-protein kinase fer from homo sapiens, northeast structural genomics consortium (nesg) target hr3461d

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase FER

SCOPe Domain Sequences for d2kk6a1:

Sequence; same for both SEQRES and ATOM records:

>d2kk6a1 d.93.1.0 (A:12-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kplaeqdwyhgaiprieaqellkkqgdflvreshgkpgeyvlsvysdgqrrhfiiqyvdn
myrfegtgfsnipqlidhhyttkqvitkksgvvllnpipkdkkwi

Timeline for d2kk6a1:

• d2kk6a1 first appeared in SCOPe 2.04, called d2kk6a_
  
• d2kk6a1 appears in SCOPe 2.06
  
• d2kk6a1 appears in the current release, SCOPe 2.08