Lineage for d2kk6a1 (2kk6 A:12-116)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530930Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2530931Protein automated matches [190561] (4 species)
    not a true protein
  7. 2530932Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 2531012Domain d2kk6a1: 2kk6 A:12-116 [242542]
    Other proteins in same PDB: d2kk6a2
    automated match to d3uyoa_

Details for d2kk6a1

PDB Entry: 2kk6 (more details)

PDB Description: solution structure of sh2 domain of proto-oncogene tyrosine-protein kinase fer from homo sapiens, northeast structural genomics consortium (nesg) target hr3461d
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase FER

SCOPe Domain Sequences for d2kk6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kk6a1 d.93.1.0 (A:12-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kplaeqdwyhgaiprieaqellkkqgdflvreshgkpgeyvlsvysdgqrrhfiiqyvdn
myrfegtgfsnipqlidhhyttkqvitkksgvvllnpipkdkkwi

SCOPe Domain Coordinates for d2kk6a1:

Click to download the PDB-style file with coordinates for d2kk6a1.
(The format of our PDB-style files is described here.)

Timeline for d2kk6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kk6a2