SCOPe 2.08: Domain d2kk0a1: 2kk0 A:12-145

Lineage for d2kk0a1 (2kk0 A:12-145)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.3: ARID-like [46774] (2 families)
   contains extra helices at both N- and C-termini

5. Family a.4.3.1: ARID domain [46775] (5 proteins)

6. Protein automated matches [190579] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187581] (4 PDB entries)

8. Domain d2kk0a1: 2kk0 A:12-145 [242541]
   Other proteins in same PDB: d2kk0a2
   automated match to d4ljxa_

Details for d2kk0a1

PDB Entry: 2kk0

PDB Description: solution structure of dead ringer-like protein 1 (at-rich interactive domain-containing protein 3a) from homo sapiens, northeast structural genomics consortium (nesg) target hr4394c

PDB Compounds: (A:) AT-rich interactive domain-containing protein 3A

SCOPe Domain Sequences for d2kk0a1:

Sequence; same for both SEQRES and ATOM records:

>d2kk0a1 a.4.3.1 (A:12-145) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdhgdwtyeeqfkqlyeldgdpkrkeflddlfsfmqkrgtpvnripimakqvldlfmlyv
lvtekgglvevinkklwreitkglnlptsitsaaftlrtqymkylypyecekrglsnpne
lqaaidsnrregrr

Timeline for d2kk0a1:

• d2kk0a1 first appeared in SCOPe 2.04, called d2kk0a_
  
• d2kk0a1 appears in SCOPe 2.07