Lineage for d2kjra_ (2kjr A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638517Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1638518Protein automated matches [190233] (10 species)
    not a true protein
  7. 1638533Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255352] (1 PDB entry)
  8. 1638534Domain d2kjra_: 2kjr A: [242540]
    automated match to d1v6ea_

Details for d2kjra_

PDB Entry: 2kjr (more details)

PDB Description: solution nmr structure of the n-terminal ubiquitin-like domain from tubulin-binding cofactor b, cg11242, from drosophila melanogaster. northeast structural genomics consortium target fr629a (residues 8- 92)
PDB Compounds: (A:) cg11242

SCOPe Domain Sequences for d2kjra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kjra_ d.15.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mghhhhhhshgksdfikvnvsnshndavafevklakdltvaqlktkleiltggcagtmkv
qvfkgdtcvstmdnndaqlgyyansdglrlhvvds

SCOPe Domain Coordinates for d2kjra_:

Click to download the PDB-style file with coordinates for d2kjra_.
(The format of our PDB-style files is described here.)

Timeline for d2kjra_: