Lineage for d2kjra1 (2kjr A:11-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933157Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255352] (2 PDB entries)
  8. 2933160Domain d2kjra1: 2kjr A:11-95 [242540]
    Other proteins in same PDB: d2kjra2
    automated match to d1v6ea_

Details for d2kjra1

PDB Entry: 2kjr (more details)

PDB Description: solution nmr structure of the n-terminal ubiquitin-like domain from tubulin-binding cofactor b, cg11242, from drosophila melanogaster. northeast structural genomics consortium target fr629a (residues 8- 92)
PDB Compounds: (A:) cg11242

SCOPe Domain Sequences for d2kjra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kjra1 d.15.1.0 (A:11-95) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gksdfikvnvsnshndavafevklakdltvaqlktkleiltggcagtmkvqvfkgdtcvs
tmdnndaqlgyyansdglrlhvvds

SCOPe Domain Coordinates for d2kjra1:

Click to download the PDB-style file with coordinates for d2kjra1.
(The format of our PDB-style files is described here.)

Timeline for d2kjra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kjra2