| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
| Protein automated matches [190233] (31 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255352] (2 PDB entries) |
| Domain d2kjra1: 2kjr A:11-95 [242540] Other proteins in same PDB: d2kjra2 automated match to d1v6ea_ |
PDB Entry: 2kjr (more details)
SCOPe Domain Sequences for d2kjra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kjra1 d.15.1.0 (A:11-95) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gksdfikvnvsnshndavafevklakdltvaqlktkleiltggcagtmkvqvfkgdtcvs
tmdnndaqlgyyansdglrlhvvds
Timeline for d2kjra1: