SCOPe 2.08: Domain d2kjca_: 2kjc A:

Lineage for d2kjca_ (2kjc A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein automated matches [191027] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [188833] (5 PDB entries)

8. Domain d2kjca_: 2kjc A: [242537]
   automated match to d1r1uc_

Details for d2kjca_

PDB Entry: 2kjc

PDB Description: solution structure of czra in the zn(ii) state

PDB Compounds: (A:) CzrA protein

SCOPe Domain Sequences for d2kjca_:

Sequence; same for both SEQRES and ATOM records:

>d2kjca_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
vkakrqgqsmiyslddihvatmlkqaihhanhpke

Timeline for d2kjca_:

• d2kjca_ first appeared in SCOPe 2.04
  
• d2kjca_ appears in SCOPe 2.07