SCOPe 2.07: Domain d2kjba_: 2kjb A:

Lineage for d2kjba_ (2kjb A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein automated matches [191027] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [188833] (5 PDB entries)

8. Domain d2kjba_: 2kjb A: [242535]
   automated match to d1r1uc_

Details for d2kjba_

PDB Entry: 2kjb

PDB Description: solution structure of czra in the dna bound state

PDB Compounds: (A:) CzrA protein

SCOPe Domain Sequences for d2kjba_:

Sequence; same for both SEQRES and ATOM records:

>d2kjba_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
vkakrqgqsmiyslddihvatmlkqaihhanhpke

Timeline for d2kjba_:

• d2kjba_ first appeared in SCOPe 2.04
  
• d2kjba_ appears in SCOPe 2.06
  
• d2kjba_ appears in the current release, SCOPe 2.08