Lineage for d2kjba_ (2kjb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693115Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693146Protein automated matches [191027] (2 species)
    not a true protein
  7. 2693147Species Staphylococcus aureus [TaxId:1280] [188833] (5 PDB entries)
  8. 2693159Domain d2kjba_: 2kjb A: [242535]
    automated match to d1r1uc_

Details for d2kjba_

PDB Entry: 2kjb (more details)

PDB Description: solution structure of czra in the dna bound state
PDB Compounds: (A:) CzrA protein

SCOPe Domain Sequences for d2kjba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kjba_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
vkakrqgqsmiyslddihvatmlkqaihhanhpke

SCOPe Domain Coordinates for d2kjba_:

Click to download the PDB-style file with coordinates for d2kjba_.
(The format of our PDB-style files is described here.)

Timeline for d2kjba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2kjbb_