![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.0: automated matches [191306] (1 protein) not a true family |
![]() | Protein automated matches [190031] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries) |
![]() | Domain d2kiva1: 2kiv A:1-69 [242531] automated match to d1b4fg_ |
PDB Entry: 2kiv (more details)
SCOPe Domain Sequences for d2kiva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kiva1 a.60.1.0 (A:1-69) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqtvgqwlesiglpqyenhlmangfdnvqamgsnvmedqdlleigilnsghrqrilqaiq llpkmrpig
Timeline for d2kiva1: