![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.159: Another 3-helical bundle [81602] (5 superfamilies) topologically similar to the DNA/RNA-binding bundles; distinct packing |
![]() | Superfamily a.159.2: FF domain [81698] (1 family) ![]() |
![]() | Family a.159.2.1: FF domain [81699] (4 proteins) |
![]() | Protein automated matches [254579] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255349] (4 PDB entries) |
![]() | Domain d2kisa1: 2kis A:618-683 [242530] Other proteins in same PDB: d2kisa2 automated match to d2doda1 |
PDB Entry: 2kis (more details)
SCOPe Domain Sequences for d2kisa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kisa1 a.159.2.1 (A:618-683) automated matches {Human (Homo sapiens) [TaxId: 9606]} learmkqfkdmllergvsafstwekelhkivfdprylllnpkerkqvfdqyvktraeeer rekknk
Timeline for d2kisa1: