SCOPe 2.08: Domain d2kisa1: 2kis A:618-683

Lineage for d2kisa1 (2kis A:618-683)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
   topologically similar to the DNA/RNA-binding bundles; distinct packing

4. Superfamily a.159.2: FF domain [81698] (1 family)

5. Family a.159.2.1: FF domain [81699] (4 proteins)

6. Protein automated matches [254579] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255349] (4 PDB entries)

8. Domain d2kisa1: 2kis A:618-683 [242530]
   Other proteins in same PDB: d2kisa2
   automated match to d2doda1

Details for d2kisa1

PDB Entry: 2kis

PDB Description: solution structure of ca150 ff1 domain and ff1-ff2 interdomain linker

PDB Compounds: (A:) Transcription elongation regulator 1

SCOPe Domain Sequences for d2kisa1:

Sequence; same for both SEQRES and ATOM records:

>d2kisa1 a.159.2.1 (A:618-683) automated matches {Human (Homo sapiens) [TaxId: 9606]}
learmkqfkdmllergvsafstwekelhkivfdprylllnpkerkqvfdqyvktraeeer
rekknk

Timeline for d2kisa1:

• d2kisa1 first appeared in SCOPe 2.04, called d2kisa_
  
• d2kisa1 appears in SCOPe 2.07