Lineage for d2khra1 (2khr A:4-74)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573862Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2573926Superfamily d.100.2: MbtH-like [160582] (2 families) (S)
    the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position
  5. 2573936Family d.100.2.0: automated matches [254253] (1 protein)
    not a true family
  6. 2573937Protein automated matches [254578] (8 species)
    not a true protein
  7. 2573950Species Mycobacterium tuberculosis [TaxId:1773] [255347] (1 PDB entry)
  8. 2573951Domain d2khra1: 2khr A:4-74 [242516]
    Other proteins in same PDB: d2khra2
    automated match to d2gpfa1

Details for d2khra1

PDB Entry: 2khr (more details)

PDB Description: solution structure of rv2377c, a mbth-like protein from mycobacterium tuberculosis
PDB Compounds: (A:) Protein mbtH

SCOPe Domain Sequences for d2khra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2khra1 d.100.2.0 (A:4-74) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mstnpfdddngaffvlvndedqhslwpvfadipagwrvvhgeasraacldyveknwtdlr
pkslrdamved

SCOPe Domain Coordinates for d2khra1:

Click to download the PDB-style file with coordinates for d2khra1.
(The format of our PDB-style files is described here.)

Timeline for d2khra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2khra2