SCOPe 2.06: Domain d2khra1: 2khr A:4-74

Lineage for d2khra1 (2khr A:4-74)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.2: MbtH-like [160582] (2 families)
   the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position

5. Family d.100.2.0: automated matches [254253] (1 protein)
   not a true family

6. Protein automated matches [254578] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [255347] (1 PDB entry)

8. Domain d2khra1: 2khr A:4-74 [242516]
   Other proteins in same PDB: d2khra2
   automated match to d2gpfa1

Details for d2khra1

PDB Entry: 2khr

PDB Description: solution structure of rv2377c, a mbth-like protein from mycobacterium tuberculosis

PDB Compounds: (A:) Protein mbtH

SCOPe Domain Sequences for d2khra1:

Sequence; same for both SEQRES and ATOM records:

>d2khra1 d.100.2.0 (A:4-74) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mstnpfdddngaffvlvndedqhslwpvfadipagwrvvhgeasraacldyveknwtdlr
pkslrdamved

Timeline for d2khra1:

• d2khra1 first appeared in SCOPe 2.04, called d2khra_
  
• d2khra1 was called d2khra_ in SCOPe 2.05
  
• d2khra1 appears in SCOPe 2.07
  
• d2khra1 appears in the current release, SCOPe 2.08