Lineage for d2khja_ (2khj A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1542164Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1542165Protein automated matches [190576] (22 species)
    not a true protein
  7. 1542201Species Escherichia coli [TaxId:562] [255345] (2 PDB entries)
  8. 1542203Domain d2khja_: 2khj A: [242512]
    automated match to d1sroa_

Details for d2khja_

PDB Entry: 2khj (more details)

PDB Description: NMR structure of the domain 6 of the E. coli ribosomal protein S1
PDB Compounds: (A:) 30S ribosomal protein S1

SCOPe Domain Sequences for d2khja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2khja_ b.40.4.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mfnnwvalnkkgaivtgkvtavdakgatveladgvegylraseasrdrvedatlvlsvgd
eveakftgvdrknraislsvrakdeadek

SCOPe Domain Coordinates for d2khja_:

Click to download the PDB-style file with coordinates for d2khja_.
(The format of our PDB-style files is described here.)

Timeline for d2khja_: