SCOP 1.65: Domain d1b09e_: 1b09 E:

Lineage for d1b09e_ (1b09 E:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)

6. Protein C-reactive protein (CRP) [49954] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49955] (3 PDB entries)

8. Domain d1b09e_: 1b09 E: [24251]
   complexed with phosphocholine

Details for d1b09e_

PDB Entry: 1b09, 2.5 Å

PDB Description: human c-reactive protein complexed with phosphocholine

SCOP Domain Sequences for d1b09e_:

Sequence; same for both SEQRES and ATOM records:

>d1b09e_ b.29.1.5 (E:) C-reactive protein (CRP) {Human (Homo sapiens)}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

Timeline for d1b09e_:

• d1b09e_ first appeared (with stable ids) in SCOP 1.55
  
• d1b09e_ appears in SCOP 1.63
  
• d1b09e_ appears in SCOP 1.67
  
• d1b09e_ appears in the current release, SCOPe 2.08