Lineage for d2kgqa_ (2kgq A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635563Family g.3.7.5: Plant defensins [57170] (9 proteins)
  6. 2635570Protein Brazzein [57178] (1 species)
    sweet protein
  7. 2635571Species J'oublie (Pentadiplandra brazzeana) [TaxId:43545] [57179] (6 PDB entries)
  8. 2635573Domain d2kgqa_: 2kgq A: [242509]
    automated match to d4he7a_

Details for d2kgqa_

PDB Entry: 2kgq (more details)

PDB Description: Refined solution structure of des-pyro Glu brazzein
PDB Compounds: (A:) brazzein

SCOPe Domain Sequences for d2kgqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kgqa_ g.3.7.5 (A:) Brazzein {J'oublie (Pentadiplandra brazzeana) [TaxId: 43545]}
dkckkvyenypvskcqlanqcnydckldkharsgecfydekrnlqcicdycey

SCOPe Domain Coordinates for d2kgqa_:

Click to download the PDB-style file with coordinates for d2kgqa_.
(The format of our PDB-style files is described here.)

Timeline for d2kgqa_: