SCOPe 2.04: Domain d2kgka_: 2kgk A:

Lineage for d2kgka_ (2kgk A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (17 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)

8. Domain d2kgka_: 2kgk A: [242508]
   automated match to d4elha_
   complexed with n22, nap

Details for d2kgka_

PDB Entry: 2kgk

PDB Description: solution structure of bacillus anthracis dihydrofolate reductase

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2kgka_:

Sequence; same for both SEQRES and ATOM records:

>d2kgka_ c.71.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Timeline for d2kgka_:

• d2kgka_ is new in SCOPe 2.04-stable
  
• d2kgka_ appears in SCOPe 2.05
  
• d2kgka_ appears in the current release, SCOPe 2.08