Lineage for d2kg0a_ (2kg0 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195631Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2195632Protein automated matches [190896] (11 species)
    not a true protein
  7. 2195664Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)
  8. 2195780Domain d2kg0a_: 2kg0 A: [242506]
    automated match to d2ek1g_
    protein/RNA complex

Details for d2kg0a_

PDB Entry: 2kg0 (more details)

PDB Description: structure of the second qrrm domain of hnrnp f in complex with a agggau g-tract rna
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein F

SCOPe Domain Sequences for d2kg0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kg0a_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsadsandgfvrlrglpfgctkeeivqffsgleivpngitlpvdpegkitgeafvqfasq
elaekalgkhkerighryievfkssqeevrsy

SCOPe Domain Coordinates for d2kg0a_:

Click to download the PDB-style file with coordinates for d2kg0a_.
(The format of our PDB-style files is described here.)

Timeline for d2kg0a_: