| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Troponin C [47503] (6 species) |
| Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries) |
| Domain d2kfxt_: 2kfx T: [242505] automated match to d3sd6a_ complexed with ca, ww7 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2kfx (more details)
SCOPe Domain Sequences for d2kfxt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kfxt_ a.39.1.5 (T:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrsmkdds
Timeline for d2kfxt_: