SCOPe 2.07: Domain d2kfta1: 2kft A:294-347

Lineage for d2kfta1 (2kft A:294-347)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)

8. Domain d2kfta1: 2kft A:294-347 [242504]
   Other proteins in same PDB: d2kfta2
   automated match to d2puyb_
   protein/DNA complex; complexed with zn

Details for d2kfta1

PDB Entry: 2kft

PDB Description: nmr solution structure of the first phd finger domain of human autoimmune regulator (aire) in complex with histone h3(1-20cys) peptide

PDB Compounds: (A:) Autoimmune regulator

SCOPe Domain Sequences for d2kfta1:

Sequence; same for both SEQRES and ATOM records:

>d2kfta1 g.50.1.0 (A:294-347) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knedecavcrdggeliccdgcprafhlaclspplreipsgtwrcssclqatvqe

Timeline for d2kfta1:

• d2kfta1 first appeared in SCOPe 2.04, called d2kfta_
  
• d2kfta1 appears in SCOPe 2.06
  
• d2kfta1 appears in the current release, SCOPe 2.08