SCOPe 2.05: Domain d2kfoa_: 2kfo A:

Lineage for d2kfoa_ (2kfo A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234629] (12 PDB entries)

8. Domain d2kfoa_: 2kfo A: [242503]
   automated match to d1xyxa_
   mutant

Details for d2kfoa_

PDB Entry: 2kfo

PDB Description: mouse prion protein (121-231) with mutation v166a

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2kfoa_:

Sequence; same for both SEQRES and ATOM records:

>d2kfoa_ d.6.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsvvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpadqysnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss

Timeline for d2kfoa_:

• d2kfoa_ first appeared in SCOPe 2.04
  
• d2kfoa_ is called d2kfoa1 in SCOPe 2.06
  
• d2kfoa_ appears in the current release, SCOPe 2.08, called d2kfoa1