Lineage for d2kfla_ (2kfl A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635622Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1635623Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1635624Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1635625Protein Prion protein domain [54100] (14 species)
  7. 1635662Species Macropus eugenii [TaxId:9315] [255344] (1 PDB entry)
  8. 1635663Domain d2kfla_: 2kfl A: [242501]
    automated match to d1u3ma_

Details for d2kfla_

PDB Entry: 2kfl (more details)

PDB Description: tammar wallaby prion protein (121-230)
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2kfla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kfla_ d.6.1.1 (A:) Prion protein domain {Macropus eugenii [TaxId: 9315]}
gsvvgglggymlgsamsrpvmhfgneyedryyrenqyrypnqvmyrpidqygsqnsfvhd
cvnitvkqhttttttkgenftetdikimervveqmcitqyqneyqaaqryyn

SCOPe Domain Coordinates for d2kfla_:

Click to download the PDB-style file with coordinates for d2kfla_.
(The format of our PDB-style files is described here.)

Timeline for d2kfla_: