Lineage for d1b09d_ (1b09 D:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226980Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 226981Protein C-reactive protein (CRP) [49954] (1 species)
  7. 226982Species Human (Homo sapiens) [TaxId:9606] [49955] (3 PDB entries)
  8. 226986Domain d1b09d_: 1b09 D: [24250]

Details for d1b09d_

PDB Entry: 1b09 (more details), 2.5 Å

PDB Description: human c-reactive protein complexed with phosphocholine

SCOP Domain Sequences for d1b09d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b09d_ b.29.1.5 (D:) C-reactive protein (CRP) {Human (Homo sapiens)}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOP Domain Coordinates for d1b09d_:

Click to download the PDB-style file with coordinates for d1b09d_.
(The format of our PDB-style files is described here.)

Timeline for d1b09d_: