Lineage for d2kfba1 (2kfb A:2-86)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773466Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2773504Protein gamma-Crystallin [49697] (9 species)
    duplication consists of two domains of this fold
  7. 2773537Species Human (Homo sapiens), isoform D [TaxId:9606] [89230] (3 PDB entries)
  8. 2773542Domain d2kfba1: 2kfb A:2-86 [242496]
    Other proteins in same PDB: d2kfba3
    automated match to d1h4ax1
    mutant

Details for d2kfba1

PDB Entry: 2kfb (more details)

PDB Description: the structure of the cataract causing p23t mutant of human gamma-d crystallin
PDB Compounds: (A:) Gamma-crystallin D

SCOPe Domain Sequences for d2kfba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kfba1 b.11.1.1 (A:2-86) gamma-Crystallin {Human (Homo sapiens), isoform D [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhtnlqpylsrcnsarvdsgcwmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsg

SCOPe Domain Coordinates for d2kfba1:

Click to download the PDB-style file with coordinates for d2kfba1.
(The format of our PDB-style files is described here.)

Timeline for d2kfba1: