Lineage for d2kf5a_ (2kf5 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170736Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2170737Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2170738Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2170739Protein Barnase [81305] (1 species)
  7. 2170740Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. 2170864Domain d2kf5a_: 2kf5 A: [242494]
    automated match to d1b3sa_

Details for d2kf5a_

PDB Entry: 2kf5 (more details)

PDB Description: barnase bound to d(cgac), low pressure
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d2kf5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kf5a_ d.1.1.2 (A:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir

SCOPe Domain Coordinates for d2kf5a_:

Click to download the PDB-style file with coordinates for d2kf5a_.
(The format of our PDB-style files is described here.)

Timeline for d2kf5a_: