Lineage for d2kf4a_ (2kf4 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1631856Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 1631857Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 1631858Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 1631859Protein Barnase [81305] (1 species)
  7. 1631860Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. 1631986Domain d2kf4a_: 2kf4 A: [242493]
    automated match to d1b3sa_

Details for d2kf4a_

PDB Entry: 2kf4 (more details)

PDB Description: barnase high pressure structure
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d2kf4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kf4a_ d.1.1.2 (A:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir

SCOPe Domain Coordinates for d2kf4a_:

Click to download the PDB-style file with coordinates for d2kf4a_.
(The format of our PDB-style files is described here.)

Timeline for d2kf4a_: