| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.5: AHSA1 domain [111168] (12 proteins) Pfam PF05146 |
| Protein automated matches [254577] (2 species) not a true protein |
| Species Bacillus subtilis [TaxId:224308] [255341] (1 PDB entry) |
| Domain d2kewa1: 2kew A:1-144 [242490] Other proteins in same PDB: d2kewa2 automated match to d1xn6a_ |
PDB Entry: 2kew (more details)
SCOPe Domain Sequences for d2kewa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kewa1 d.129.3.5 (A:1-144) automated matches {Bacillus subtilis [TaxId: 224308]}
maqnnenalpditksitleapiqkvwetvstsegiakwfmpndfqlkegqefhlqspfgp
spckvlavqaptelsfewdtegwvvtfqledlgektgftlihsgwkepnqvigkanekss
vvrgkmdggwtgivnerlrkavee
Timeline for d2kewa1: