Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) |
Family d.120.1.0: automated matches [191500] (1 protein) not a true family |
Protein automated matches [190822] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225917] (2 PDB entries) |
Domain d2keoa_: 2keo A: [242487] automated match to d1hkoa_ |
PDB Entry: 2keo (more details)
SCOPe Domain Sequences for d2keoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2keoa_ d.120.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ekvtlvriadlenhnndggfwtvidgkvydikdfqtqsltensilaqfagedpvvaleaa lqfedtresmhafcvgqylepdqegvtipdlg
Timeline for d2keoa_: