Lineage for d2keoa_ (2keo A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973074Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2973075Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2973189Family d.120.1.0: automated matches [191500] (1 protein)
    not a true family
  6. 2973190Protein automated matches [190822] (5 species)
    not a true protein
  7. 2973194Species Human (Homo sapiens) [TaxId:9606] [225917] (2 PDB entries)
  8. 2973197Domain d2keoa_: 2keo A: [242487]
    automated match to d1hkoa_

Details for d2keoa_

PDB Entry: 2keo (more details)

PDB Description: Solution NMR structure of human protein HS00059, cytochrome-b5-like domain of the HERC2 E3 ligase. Northeast structural genomics consortium (NESG) target ht98a
PDB Compounds: (A:) Probable E3 ubiquitin-protein ligase HERC2

SCOPe Domain Sequences for d2keoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2keoa_ d.120.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekvtlvriadlenhnndggfwtvidgkvydikdfqtqsltensilaqfagedpvvaleaa
lqfedtresmhafcvgqylepdqegvtipdlg

SCOPe Domain Coordinates for d2keoa_:

Click to download the PDB-style file with coordinates for d2keoa_.
(The format of our PDB-style files is described here.)

Timeline for d2keoa_: