Lineage for d2keib_ (2kei B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709593Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 2709609Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 2709610Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)
  8. 2709631Domain d2keib_: 2kei B: [242482]
    automated match to d1l1ma_
    protein/DNA complex

Details for d2keib_

PDB Entry: 2kei (more details)

PDB Description: refined solution structure of a dimer of lac repressor dna-binding domain complexed to its natural operator o1
PDB Compounds: (B:) lactose operon repressor

SCOPe Domain Sequences for d2keib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2keib_ a.35.1.5 (B:) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
sl

SCOPe Domain Coordinates for d2keib_:

Click to download the PDB-style file with coordinates for d2keib_.
(The format of our PDB-style files is described here.)

Timeline for d2keib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2keia_