SCOPe 2.06: Domain d1b09b_: 1b09 B:

Lineage for d1b09b_ (1b09 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
   automatically mapped to Pfam PF00354

6. Protein C-reactive protein (CRP) [49954] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49955] (6 PDB entries)

8. Domain d1b09b_: 1b09 B: [24248]
   complexed with phosphocholine
   complexed with ca, pc

Details for d1b09b_

PDB Entry: 1b09, 2.5 Å

PDB Description: human c-reactive protein complexed with phosphocholine

PDB Compounds: (B:) protein (c-reactive protein)

SCOPe Domain Sequences for d1b09b_:

Sequence; same for both SEQRES and ATOM records:

>d1b09b_ b.29.1.5 (B:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

Timeline for d1b09b_:

• d1b09b_ first appeared (with stable ids) in SCOP 1.55
  
• d1b09b_ appears in SCOPe 2.05
  
• d1b09b_ appears in SCOPe 2.07
  
• d1b09b_ appears in the current release, SCOPe 2.08