Lineage for d1b09b_ (1b09 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 57942Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 57943Protein C-reactive protein (CRP) [49954] (1 species)
  7. 57944Species Human (Homo sapiens) [TaxId:9606] [49955] (2 PDB entries)
  8. 57946Domain d1b09b_: 1b09 B: [24248]

Details for d1b09b_

PDB Entry: 1b09 (more details), 2.5 Å

PDB Description: human c-reactive protein complexed with phosphocholine

SCOP Domain Sequences for d1b09b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b09b_ b.29.1.5 (B:) C-reactive protein (CRP) {Human (Homo sapiens)}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOP Domain Coordinates for d1b09b_:

Click to download the PDB-style file with coordinates for d1b09b_.
(The format of our PDB-style files is described here.)

Timeline for d1b09b_: