Lineage for d2kdza2 (2kdz A:50-107)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692885Species Trichomonas vaginalis [TaxId:5722] [233124] (4 PDB entries)
  8. 2692897Domain d2kdza2: 2kdz A:50-107 [242474]
    automated match to d3osga2
    protein/DNA complex

Details for d2kdza2

PDB Entry: 2kdz (more details)

PDB Description: structure of the r2r3 dna binding domain of myb1 protein from protozoan parasite trichomonas vaginalis in complex with mre-1/mre-2r dna
PDB Compounds: (A:) myb24

SCOPe Domain Sequences for d2kdza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kdza2 a.4.1.0 (A:50-107) automated matches {Trichomonas vaginalis [TaxId: 5722]}
alrtdpwspeedmlldqkyaeygpkwnkiskflknrsdnnirnrwmmiarhrakhqks

SCOPe Domain Coordinates for d2kdza2:

Click to download the PDB-style file with coordinates for d2kdza2.
(The format of our PDB-style files is described here.)

Timeline for d2kdza2: