| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
| Protein automated matches [190674] (25 species) not a true protein |
| Species Trichomonas vaginalis [TaxId:5722] [233124] (4 PDB entries) |
| Domain d2kdza1: 2kdz A:1-49 [242473] automated match to d3osgd1 protein/DNA complex |
PDB Entry: 2kdz (more details)
SCOPe Domain Sequences for d2kdza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kdza1 a.4.1.0 (A:1-49) automated matches {Trichomonas vaginalis [TaxId: 5722]}
kvkfteeedlklqqlvmrygakdwirisqlmitrnprqcrerwnnyinp
Timeline for d2kdza1: