SCOPe 2.08: Domain d2kdha1: 2kdh A:91-161

Lineage for d2kdha1 (2kdh A:91-161)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries)

8. Domain d2kdha1: 2kdh A:91-161 [242470]
   Other proteins in same PDB: d2kdha2
   automated match to d1ozsa_
   complexed with ca, kdh
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2kdha1

PDB Entry: 2kdh

PDB Description: the solution structure of human cardiac troponin c in complex with the green tea polyphenol; (-)-epigallocatechin-3-gallate

PDB Compounds: (A:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d2kdha1:

Sequence; same for both SEQRES and ATOM records:

>d2kdha1 a.39.1.5 (A:91-161) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
gkseeelsdlfrmfdknadgyidldelkimlqatgetiteddieelmkdgdknndgridy
deflefmkgve

Timeline for d2kdha1:

• d2kdha1 first appeared in SCOPe 2.04, called d2kdha_
  
• d2kdha1 was called d2kdha_ in SCOPe 2.07